PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009776133.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family FAR1
Protein Properties Length: 829aa    MW: 93996.2 Da    PI: 6.7862
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009776133.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR127.21.3e-0845864990
            FAR1 49 ekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90
                    ++  +++++   +C+a+l+v+++ ++kw+vtk ++eH+H+l+
  XP_009776133.1 45 DEVVEPQTVYGESCDAMLRVELKGQNKWVVTKYVKEHSHSLV 86
                    3566678888899***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031013.2E-64586IPR004330FAR1 DNA binding domain
PfamPF105512.0E-27224315IPR018289MULE transposase domain
PROSITE profilePS5096611.226502538IPR007527Zinc finger, SWIM-type
PfamPF044341.5E-9502536IPR007527Zinc finger, SWIM-type
SMARTSM005751.8E-6513540IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009506Cellular Componentplasmodesma
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 829 aa     Download sequence    Send to blast
MDVEVIDVEQ GSMQHQGGIT DDGDDEPSES GEANVNGRSN APERDEVVEP QTVYGESCDA  60
MLRVELKGQN KWVVTKYVKE HSHSLVHPNK VHYHTSHRHF AVAKKNGPEN NQGVGIVPSG  120
VMYVSVDGNR IPLEINRGAK STRSAESDQT VKDNVPQSFS PRQCNQRRTL GRDAQNLLNY  180
FKKMQAENPG FYYAIQLDKD NRMANVFWAD ARSRNAYSHF GDAVILDTMY RVNQCRVPFA  240
PFTGVNHHGQ TILFGCALLL DESEATFVWL FKTFLAAMND RAPVSIITDQ DTVIQSAVAQ  300
VFPGTRHCIN KWHVLRGGQD RMAHVCHMYP NFQVELYNCI NLTETVEEFE SYWETILEKY  360
DLKKNDWLQS IYNTRRQWVP AYFRDTFFAA LSPNQEYECS FFDGYVNQQI TLPLFFRQYE  420
RALENSFEKE IEADFDTICT TPPLRTPSPM EKQAATLYTK KIFLKFQEEL VETFVYTANR  480
IDGDGALSTF RVAKFEDDQK AYVVSLNISE LKANCSCQMF ECSGILCRHI LTVFTVTNVL  540
TLPSHYILKR WTINAKCRAE SDDHVQLHGT ESMAQKYNSL CREAIRYAEE GAVAQETYKA  600
ALAALKEGGK KVALAKRNVA KVSPPSSQVS GVGYDDRRTS ASAPEMTPLL WPRQDEMTKR  660
FNLNDTGIPA RTIADLNAQR MAPVSLHRGD GHADNTVILP CLKSMTWVME NKTSTPANRV  720
AVINLKLQDY SRTLSRESEV KFQLSRVTLE PMLKSMAYIS EQLSTPANRV AVINLKLQDT  780
ETTSGESEVK FQVSRDTLAA MLRSMAYIRE QLSNTVESQL ENPAKKQRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754450.0HG975445.1 Solanum pennellii chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009776133.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 3 isoform X3
SwissprotQ9ZVC90.0FRS3_ARATH; Protein FAR1-RELATED SEQUENCE 3
TrEMBLA0A0V0IVH00.0A0A0V0IVH0_SOLCH; Uncharacterized protein
STRINGPOPTR_0009s16010.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G27110.20.0FAR1-related sequence 3